ARMCX3 monoclonal antibody (M01), clone 2G3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
ARMCX3 monoclonal antibody (M01), clone 2G3. Western Blot analysis of ARMCX3 expression in Hela S3 NE.
Western Blot (Cell lysate)
ARMCX3 monoclonal antibody (M01), clone 2G3. Western Blot analysis of ARMCX3 expression in U-2 OS.
Western Blot (Transfected lysate)
Western Blot analysis of ARMCX3 expression in transfected 293T cell line by ARMCX3 monoclonal antibody (M01), clone 2G3.
Lane 1: ARMCX3 transfected lysate (Predicted MW: 42.5 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ARMCX3 is approximately 0.1ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.96 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ARMCX3.
Immunogen
ARMCX3 (NP_057691, 278 a.a. ~ 379 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RELLRAQVPSSLGSLFNKKENKEVILKLLVIFENINDNFKWEENEPTQNQFGEGSLFFFLKEFQVCADKVLGIESHHDFLVKVKVGKFMAKLAEHMFPKSQE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (89); Rat (87)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.96 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ARMCX3 monoclonal antibody (M01), clone 2G3. Western Blot analysis of ARMCX3 expression in Hela S3 NE.Western Blot (Cell lysate)
ARMCX3 monoclonal antibody (M01), clone 2G3. Western Blot analysis of ARMCX3 expression in U-2 OS.Western Blot (Transfected lysate)
Western Blot analysis of ARMCX3 expression in transfected 293T cell line by ARMCX3 monoclonal antibody (M01), clone 2G3.
Lane 1: ARMCX3 transfected lysate (Predicted MW: 42.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ARMCX3 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — ARMCX3
Entrez GeneID
51566GeneBank Accession#
NM_016607Protein Accession#
NP_057691Gene Name
ARMCX3
Gene Alias
ALEX3, DKFZp781N1954, KIAA0443, MGC12199, dJ545K15.2
Gene Description
armadillo repeat containing, X-linked 3
Omim ID
300364Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the ALEX family of proteins which may play a role in tumor suppression. The encoded protein contains a potential N-terminal transmembrane domain and a single Armadillo (arm) repeat. Other proteins containing the arm repeat are involved in development, maintenance of tissue integrity, and tumorigenesis. This gene is closely localized with other family members on the X chromosome. Three transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq
Other Designations
1200004E24Rik|OTTHUMP00000023688|arm protein lost in epithelial cancers, X chromosome, 3
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com