IL23A (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Human IL23A full-length ORF ( NP_057668.1, 1 a.a. - 189 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
47.1
Interspecies Antigen Sequence
Mouse (75)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — IL23A
Entrez GeneID
51561GeneBank Accession#
NM_016584.2Protein Accession#
NP_057668.1Gene Name
IL23A
Gene Alias
IL-23, IL-23A, IL23P19, MGC79388, P19, SGRF
Gene Description
interleukin 23, alpha subunit p19
Omim ID
605580Gene Ontology
HyperlinkGene Summary
This gene encodes a subunit of the heterodimeric cytokine interleukin 23 (IL23). IL23 is composed of this protein and the p40 subunit of interleukin 12 (IL12B). The receptor of IL23 is formed by the beta 1 subunit of IL12 (IL12RB1) and an IL23 specific subunit, IL23R. Both IL23 and IL12 can activate the transcription activator STAT4, and stimulate the production of interferon-gamma (IFNG). In contrast to IL12, which acts mainly on naive CD4(+) T cells, IL23 preferentially acts on memory CD4(+) T cells. [provided by RefSeq
Other Designations
JKA3 induced upon T-cell activation|interleukin 23 p19 subunit
-
Interactomes
-
Pathways
-
Diseases
-
Publication Reference
-
Damage effect of interleukin (IL)-23 on oxygen-glucose-deprived cells of the neurovascular unit via IL-23 receptor.
Wang M, Zhong D, Zheng Y, Li H, Chen H, Ma S, Sun Y, Yan W, Li G.
Neuroscience 2015 Mar; 289:406.
Application:Treatment, Rat, Brain microvascular endothelial cells.
-
Damage effect of interleukin (IL)-23 on oxygen-glucose-deprived cells of the neurovascular unit via IL-23 receptor.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com