IL23A monoclonal antibody (M01), clone 4C8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
IL23A monoclonal antibody (M01), clone 4C8. Western Blot analysis of IL23A expression in human lung cancer.
Western Blot (Transfected lysate)
Western Blot analysis of IL23A expression in transfected 293T cell line by IL23A monoclonal antibody (M01), clone 4C8.
Lane 1: IL23A transfected lysate (Predicted MW: 20.7 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged IL23A is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (47.1 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant IL23A.
Immunogen
IL23A (NP_057668.1, 1 a.a. ~ 189 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (75)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (47.1 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
IL23A monoclonal antibody (M01), clone 4C8. Western Blot analysis of IL23A expression in human lung cancer.Western Blot (Transfected lysate)
Western Blot analysis of IL23A expression in transfected 293T cell line by IL23A monoclonal antibody (M01), clone 4C8.
Lane 1: IL23A transfected lysate (Predicted MW: 20.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged IL23A is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — IL23A
Entrez GeneID
51561GeneBank Accession#
NM_016584.2Protein Accession#
NP_057668.1Gene Name
IL23A
Gene Alias
IL-23, IL-23A, IL23P19, MGC79388, P19, SGRF
Gene Description
interleukin 23, alpha subunit p19
Omim ID
605580Gene Ontology
HyperlinkGene Summary
This gene encodes a subunit of the heterodimeric cytokine interleukin 23 (IL23). IL23 is composed of this protein and the p40 subunit of interleukin 12 (IL12B). The receptor of IL23 is formed by the beta 1 subunit of IL12 (IL12RB1) and an IL23 specific subunit, IL23R. Both IL23 and IL12 can activate the transcription activator STAT4, and stimulate the production of interferon-gamma (IFNG). In contrast to IL12, which acts mainly on naive CD4(+) T cells, IL23 preferentially acts on memory CD4(+) T cells. [provided by RefSeq
Other Designations
JKA3 induced upon T-cell activation|interleukin 23 p19 subunit
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com