Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RAB14 (Human) Recombinant Protein (P01)

  • Catalog # : H00051552-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human RAB14 full-length ORF ( AAH06081, 1 a.a. - 215 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MATAPYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCGC
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 49.39
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00051552-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • RAB14
  • Gene Alias:
  • FBP,RAB-14
  • Gene Description:
  • RAB14, member RAS oncogene family
  • Gene Summary:
  • RAB14 belongs to the large RAB family of low molecular mass GTPases that are involved in intracellular membrane trafficking. These proteins act as molecular switches that flip between an inactive GDP-bound state and an active GTP-bound state in which they recruit downstream effector proteins onto membranes (Junutula et al., 2004 [PubMed 15004230]).[supplied by OMIM
  • Other Designations:
  • F protein-binding protein 1,GTPase Rab14,OTTHUMP00000022008,bA165P4.3 (member RAS oncogene family),small GTP binding protein RAB14
  • RSS
  • YouTube
  • Linkedin
  • Facebook