ANAPC11 monoclonal antibody (M01), clone 1B4-1A4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant ANAPC11.
Immunogen
ANAPC11 (AAH00607, 1 a.a. ~ 54 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MGPGPVGKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (91); Rat (91)
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (31.68 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ANAPC11 is approximately 0.03ng/ml as a capture antibody.ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between CDC20 and ANAPC11. HeLa cells were stained with anti-CDC20 rabbit purified polyclonal 1:1200 and anti-ANAPC11 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — ANAPC11
Entrez GeneID
51529GeneBank Accession#
BC000607Protein Accession#
AAH00607Gene Name
ANAPC11
Gene Alias
APC11, Apc11p, HSPC214, MGC882
Gene Description
anaphase promoting complex subunit 11
Gene Ontology
HyperlinkOther Designations
APC11 anaphase promoting complex subunit 11|APC11 anaphase promoting complex subunit 11 homolog|anaphase promoting complex subunit 11 (yeast APC11 homolog)
-
Interactome
-
Pathway
-
Publication Reference
-
Integrated analysis highlights APC11 protein expression as a likely new independent predictive marker for colorectal cancer.
Drouet Y, Treilleux I, Viari A, Léon S, Devouassoux-Shisheboran M, Voirin N, de la Fouchardière C, Manship B, Puisieux A, Lasset C, Moyret-Lalle C.
Scientific Reports 2018 May; 8(1):7386.
Application:WB-Ce, Human, TC7, TC71, IS-2, HCT-15, HT-29, Co-115, Lovo, SW-480, SW-620, SW-1116 cells.
-
Integrated analysis highlights APC11 protein expression as a likely new independent predictive marker for colorectal cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com