Product Browser

Last updated: 2016/11/27
  • Related Product Showcase
  • By Research Area

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NOP16 MaxPab rabbit polyclonal antibody (D01)MaxPab

  • Catalog # : H00051491-D01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human NOP16 protein.
  • Immunogen:
  • NOP16 (AAH40106.1, 1 a.a. ~ 178 a.a) full-length human protein.
  • Sequence:
  • MPKAKGKTRRQKFGYSVNRKRLNRNARRKAAPRIECSHIRHAWDHAKSVRQNLAEMGLAVDPNRAVPLRKRKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVRYMVENHGEDYKAMARDEKNYYQDTPKQIRSKINVYKRFYPAEWQDFLDSLQKRKMEVE
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • HSPC111 MaxPab rabbit polyclonal antibody. Western Blot analysis of HSPC111 expression in human liver.
  • PDF DownloadProtocol Download
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • HSPC111 MaxPab rabbit polyclonal antibody. Western Blot analysis of HSPC111 expression in mouse spleen.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • HSPC111 MaxPab rabbit polyclonal antibody. Western Blot analysis of HSPC111 expression in A-431.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of NOP16 expression in transfected 293T cell line (H00051491-T03) by NOP16 MaxPab polyclonal antibody.

    Lane 1: NOP16 transfected lysate(21.2 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of NOP16 transfected lysate using anti-NOP16 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with NOP16 purified MaxPab mouse polyclonal antibody (B01P) (H00051491-B01P).
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • NOP16
  • Gene Alias:
  • HSPC111,HSPC185
  • Gene Description:
  • NOP16 nucleolar protein homolog (yeast)
  • Gene Summary:
  • NOP16 is transcriptionally regulated by c-Myc (MYC; MIM 190080), upregulated in breast cancer, and overexpression is associated with poor patient survival (Butt et al., 2008).[supplied by OMIM
  • Other Designations:
  • HBV pre-S2 trans-regulated protein 3,NOP16 nucleolar protein homolog,nucleolar protein 16 homolog
  • RSS
  • YouTube
  • Linkedin
  • Facebook