HSPC111 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
NOP16 MaxPab polyclonal antibody. Western Blot analysis of NOP16 expression in NIH/3T3.
Western Blot (Cell lysate)
NOP16 MaxPab polyclonal antibody. Western Blot analysis of NOP16 expression in Raw 264.7.
Western Blot (Cell lysate)
NOP16 MaxPab polyclonal antibody. Western Blot analysis of NOP16 expression in PC-12.
Western Blot (Cell lysate)
HSPC111 MaxPab polyclonal antibody. Western Blot analysis of HSPC111 expression in HeLa.
Western Blot (Transfected lysate)
Western Blot analysis of NOP16 expression in transfected 293T cell line (H00051491-T01) by NOP16 MaxPab polyclonal antibody.
Lane 1: HSPC111 transfected lysate(19.58 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of purified MaxPab antibody to HSPC111 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 3 ug/ml]
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to HSPC111 on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human HSPC111 protein.
Immunogen
HSPC111 (AAH40106.1, 1 a.a. ~ 178 a.a) full-length human protein.
Sequence
MPKAKGKTRRQKFGYSVNRKRLNRNARRKAAPRIECSHIRHAWDHAKSVRQNLAEMGLAVDPNRAVPLRKRKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVRYMVENHGEDYKAMARDEKNYYQDTPKQIRSKINVYKRFYPAEWQDFLDSLQKRKMEVE
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (91); Rat (91)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
NOP16 MaxPab polyclonal antibody. Western Blot analysis of NOP16 expression in NIH/3T3.Western Blot (Cell lysate)
NOP16 MaxPab polyclonal antibody. Western Blot analysis of NOP16 expression in Raw 264.7.Western Blot (Cell lysate)
NOP16 MaxPab polyclonal antibody. Western Blot analysis of NOP16 expression in PC-12.Western Blot (Cell lysate)
HSPC111 MaxPab polyclonal antibody. Western Blot analysis of HSPC111 expression in HeLa.Western Blot (Transfected lysate)
Western Blot analysis of NOP16 expression in transfected 293T cell line (H00051491-T01) by NOP16 MaxPab polyclonal antibody.
Lane 1: HSPC111 transfected lysate(19.58 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of purified MaxPab antibody to HSPC111 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 3 ug/ml]Immunofluorescence
Immunofluorescence of purified MaxPab antibody to HSPC111 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — NOP16
Entrez GeneID
51491GeneBank Accession#
BC040106Protein Accession#
AAH40106.1Gene Name
NOP16
Gene Alias
HSPC111, HSPC185
Gene Description
NOP16 nucleolar protein homolog (yeast)
Gene Ontology
HyperlinkGene Summary
NOP16 is transcriptionally regulated by c-Myc (MYC; MIM 190080), upregulated in breast cancer, and overexpression is associated with poor patient survival (Butt et al., 2008).[supplied by OMIM
Other Designations
HBV pre-S2 trans-regulated protein 3|NOP16 nucleolar protein homolog|nucleolar protein 16 homolog
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com