VCX3A purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human VCX3A protein.
Immunogen
VCX3A (AAH98149.1, 1 a.a. ~ 166 a.a) full-length human protein.
Sequence
MSPKPRASGPPAKATEAGKRKSSSQPSPSDPKKKTTKVAKKGKAVRRGRRGKKGAATKMAAVTAPEAESGPAAPGPSDQPSQELPQHELPPEEPVSEGTQHDPLSQESELEEPLSQESEVEEPLSQESQVEEPLSQESEVEEPLSQESQVEEPLSQESEMEELPSM
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of VCX3A expression in transfected 293T cell line (H00051481-T01) by VCX3A MaxPab polyclonal antibody.
Lane 1: VCX3A transfected lysate(18.26 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to VCX3A on HeLa cell. [antibody concentration 7 ug/ml] -
Gene Info — VCX3A
Entrez GeneID
51481GeneBank Accession#
BC098149.1Protein Accession#
AAH98149.1Gene Name
VCX3A
Gene Alias
MGC118976, MGC125730, MGC125796, VCX-8r, VCX-A, VCX3, VCX8R, VCXA
Gene Description
variable charge, X-linked 3A
Omim ID
300533Gene Ontology
HyperlinkGene Summary
This gene belongs to the VCX/Y gene family, which has multiple members on both X and Y chromosomes, and all are expressed exclusively in male germ cells. The X-linked members are clustered on chromosome Xp22 and Y-linked members are two identical copies of the gene within a palindromic region on Yq11. The family members share a high degree of sequence identity, with the exception that a 30-bp unit is tandemly repeated in X-linked members but occurs only once in Y-linked members. The VCX gene cluster is polymorphic in terms of copy number; different individuals may have a different number of VCX genes. VCX/Y genes encode small and highly charged proteins of unknown function. The presence of a putative bipartite nuclear localization signal suggests that VCX/Y members are nuclear proteins. This gene contains 8 repeats of the 30-bp unit. [provided by RefSeq
Other Designations
OTTHUMP00000022866|variable charge protein on X with eight repeats|variably charged X-A
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com