Product Browser

Last updated: 2017/10/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DCDC2 polyclonal antibody (A01)

  • Catalog # : H00051473-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant DCDC2.
  • Immunogen:
  • DCDC2 (NP_057440, 377 a.a. ~ 476 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • GGREATDAPEQVEEILDHSEQQARPARVNGGTDEENGEELQQVNNELQLVLDKERKSQGAGSGQDEADVDPQRPPRPEVKITSPEENENNQQNKDYAAVA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00051473-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • DCDC2
  • Gene Alias:
  • DCDC2A,RU2,RU2S
  • Gene Description:
  • doublecortin domain containing 2
  • Gene Summary:
  • This gene encodes a protein with two doublecortin peptide domains. This domain has been demonstrated to bind tubulin and enhance microtubule polymerization. Mutations in this gene have been associated with Reading Disability (RD), also referred to as developmental dyslexia. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000017887
  • RSS
  • YouTube
  • Linkedin
  • Facebook