NAT8B monoclonal antibody (M03), clone 3B6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NAT8B is 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.41 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NAT8B.
Immunogen
NAT8B (NP_057431.1, 83 a.a. ~ 179 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TRYVDIALRTDMSDITKSYLSECGSCFWVGESEEKVVGTVGALPVDDPTLREKRLQLFHLSVDNEHRGQGIAKALVRTVLQFARDQGYSEVVLDTSN
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Rat (71)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.41 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NAT8B is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — NAT8B
Entrez GeneID
51471GeneBank Accession#
NM_016347Protein Accession#
NP_057431.1Gene Name
NAT8B
Gene Alias
CML2, Hcml2, MGC97061, NAT8BP
Gene Description
N-acetyltransferase 8B (GCN5-related, putative, gene/pseudogene)
Omim ID
608190Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is highly similar to the N-acetyltransferase 8 (NAT8) gene product, which is a kidney and liver protein with homology to bacterial acetyltransferases involved in drug resistance. This gene is localized on chromosome 2 in the vicinity of the NAT8 gene and may represent a pseudogene of NAT8. This gene contains two polymorphic nonsense mutations that disrupt the active site of the protein. The full-length product of this gene contains a complete acetyltransferase domain and is identical in length to NAT8. [provided by RefSeq
Other Designations
N-acetyltransferase 8B|N-acetyltransferase 8B (gene/pseudogene)|N-acetyltransferase Camello 2
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com