SFMBT1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human SFMBT1 partial ORF ( NP_057413, 121 a.a. - 230 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
EGIRDKVSDWDEFLRQTLIGACSPPVPLLEGLRNGRNPLDLIAPGSRLECQAFQDSLSTWIVTVVENIGGRLKLRYEGLESSDNYEHWLYYLDPFLHHVGWAAQQGYELQ
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.51
Interspecies Antigen Sequence
Mouse (86); Rat (85)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — SFMBT1
Entrez GeneID
51460GeneBank Accession#
NM_016329Protein Accession#
NP_057413Gene Name
SFMBT1
Gene Alias
DKFZp434L243, RU1, SFMBT
Gene Description
Scm-like with four mbt domains 1
Omim ID
607319Gene Ontology
HyperlinkGene Summary
This gene shares high similarity with the Drosophila Scm (sex comb on midleg) gene. It encodes a protein which contains four malignant brain tumor repeat (mbt) domains and may be involved in antigen recognition. Several alternative splice variants have been characterized. [provided by RefSeq
Other Designations
Scm-related gene containing four mbt domains|Scm-related gene product containing four mbt domains
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com