Product Browser

Last updated: 2017/6/18

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SFMBT1 polyclonal antibody (A01)

  • Catalog # : H00051460-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant SFMBT1.
  • Immunogen:
  • SFMBT1 (NP_057413, 121 a.a. ~ 230 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • EGIRDKVSDWDEFLRQTLIGACSPPVPLLEGLRNGRNPLDLIAPGSRLECQAFQDSLSTWIVTVVENIGGRLKLRYEGLESSDNYEHWLYYLDPFLHHVGWAAQQGYELQ
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00051460-A01
    Western Blot detection against Immunogen (38.1 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of SFMBT1 expression in transfected 293T cell line by SFMBT1 polyclonal antibody (A01).

    Lane1:SFMBT1 transfected lysate (Predicted MW: 98.1 KDa).
    Lane2:Non-transfected lysate.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • SFMBT1
  • Gene Alias:
  • DKFZp434L243,RU1,SFMBT
  • Gene Description:
  • Scm-like with four mbt domains 1
  • Gene Summary:
  • This gene shares high similarity with the Drosophila Scm (sex comb on midleg) gene. It encodes a protein which contains four malignant brain tumor repeat (mbt) domains and may be involved in antigen recognition. Several alternative splice variants have been characterized. [provided by RefSeq
  • Other Designations:
  • Scm-related gene containing four mbt domains,Scm-related gene product containing four mbt domains
  • RSS
  • YouTube
  • Linkedin
  • Facebook