RHCG monoclonal antibody (M06), clone 5A4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
RHCG monoclonal antibody (M06), clone 5A4 Western Blot analysis of RHCG expression in PC-12 ( Cat # L012V1 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to RHCG on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]
Western Blot detection against Immunogen (32.56 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RHCG.
Immunogen
RHCG (NP_057405, 418 a.a. ~ 479 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LPFWGQPSDENCFEDAVYWEMPEGNSTVYIPEDPTFKPSGPSVPSVPMVSPLPMASSVPLVP
Host
Mouse
Reactivity
Human, Rat
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (32.56 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RHCG monoclonal antibody (M06), clone 5A4 Western Blot analysis of RHCG expression in PC-12 ( Cat # L012V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to RHCG on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]ELISA
-
Gene Info — RHCG
Entrez GeneID
51458GeneBank Accession#
NM_016321Protein Accession#
NP_057405Gene Name
RHCG
Gene Alias
C15orf6, PDRC2, RHGK, SLC42A3
Gene Description
Rh family, C glycoprotein
Omim ID
605381Gene Ontology
HyperlinkGene Summary
O
Other Designations
Rh type C glycoprotein|Rhesus blood group, C glycoprotein
-
Interactome
-
Disease
-
Publication Reference
-
Remodeling of the Fetal Collecting Duct Epithelium.
Hiatt MJ, Ivanova L, Toran N, Tarantal AF, Matsell DG.
The American Journal of Pathology 2010 Feb; 176(2):630.
Application：IF, IHC-P, Human, Human fetal kidney.
-
Remodeling of the Fetal Collecting Duct Epithelium.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com