PRRX2 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PRRX2 partial ORF ( NP_057391, 110 a.a. - 202 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
TFNSSQLQALERVFERTHYPDAFVREELARRVNLSEARVQVWFQNRRAKFRRNERAMLASRSASLLKSYSQEAAIEQPVAPRPTALSPDYLSW
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
35.97
Interspecies Antigen Sequence
Mouse (96); Rat (97)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — PRRX2
Entrez GeneID
51450GeneBank Accession#
NM_016307Protein Accession#
NP_057391Gene Name
PRRX2
Gene Alias
MGC19843, PMX2, PRX2
Gene Description
paired related homeobox 2
Omim ID
604675Gene Ontology
HyperlinkGene Summary
The DNA-associated protein encoded by this gene is a member of the paired family of homeobox proteins. Expression is localized to proliferating fetal fibroblasts and the developing dermal layer, with downregulated expression in adult skin. Increases in expression of this gene during fetal but not adult wound healing suggest a possible role in mechanisms that control mammalian dermal regeneration and prevent formation of scar response to wounding. The expression patterns provide evidence consistent with a role in fetal skin development and a possible role in cellular proliferation. [provided by RefSeq
Other Designations
OTTHUMP00000022344|paired mesoderm homeobox protein 2|paired-like homeodomain protein PRX2|predicted NUP98/PRRX2 fusion protein
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com