PRRX2 monoclonal antibody (M01), clone 4C9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of PRRX2 expression in transfected 293T cell line by PRRX2 monoclonal antibody (M01), clone 4C9.
Lane 1: PRRX2 transfected lysate(27.1 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PRRX2 is 0.1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.07 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PRRX2.
Immunogen
PRRX2 (NP_057391.1, 151 a.a. ~ 253 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
WFQNRRAKFRRNERAMLASRSASLLKSYSQEAAIEQPVAPRPTALSPDYLSWTASSPYSTVPPYSPGSSGPATPGVNMANSIASLRLKAKEFSLHHSQVPTVN
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (92); Rat (93)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.07 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of PRRX2 expression in transfected 293T cell line by PRRX2 monoclonal antibody (M01), clone 4C9.
Lane 1: PRRX2 transfected lysate(27.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PRRX2 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — PRRX2
Entrez GeneID
51450GeneBank Accession#
NM_016307Protein Accession#
NP_057391.1Gene Name
PRRX2
Gene Alias
MGC19843, PMX2, PRX2
Gene Description
paired related homeobox 2
Omim ID
604675Gene Ontology
HyperlinkGene Summary
The DNA-associated protein encoded by this gene is a member of the paired family of homeobox proteins. Expression is localized to proliferating fetal fibroblasts and the developing dermal layer, with downregulated expression in adult skin. Increases in expression of this gene during fetal but not adult wound healing suggest a possible role in mechanisms that control mammalian dermal regeneration and prevent formation of scar response to wounding. The expression patterns provide evidence consistent with a role in fetal skin development and a possible role in cellular proliferation. [provided by RefSeq
Other Designations
OTTHUMP00000022344|paired mesoderm homeobox protein 2|paired-like homeodomain protein PRX2|predicted NUP98/PRRX2 fusion protein
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com