Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PRRX2 polyclonal antibody (A01)

  • Catalog # : H00051450-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PRRX2.
  • Immunogen:
  • PRRX2 (NP_057391, 110 a.a. ~ 202 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • TFNSSQLQALERVFERTHYPDAFVREELARRVNLSEARVQVWFQNRRAKFRRNERAMLASRSASLLKSYSQEAAIEQPVAPRPTALSPDYLSW
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00051450-A01
    Western Blot detection against Immunogen (36.34 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • PRRX2
  • Gene Alias:
  • MGC19843,PMX2,PRX2
  • Gene Description:
  • paired related homeobox 2
  • Gene Summary:
  • The DNA-associated protein encoded by this gene is a member of the paired family of homeobox proteins. Expression is localized to proliferating fetal fibroblasts and the developing dermal layer, with downregulated expression in adult skin. Increases in expression of this gene during fetal but not adult wound healing suggest a possible role in mechanisms that control mammalian dermal regeneration and prevent formation of scar response to wounding. The expression patterns provide evidence consistent with a role in fetal skin development and a possible role in cellular proliferation. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000022344,paired mesoderm homeobox protein 2,paired-like homeodomain protein PRX2,predicted NUP98/PRRX2 fusion protein
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook