PRRX2 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot detection against Immunogen (36.34 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant PRRX2.
Immunogen
PRRX2 (NP_057391, 110 a.a. ~ 202 a.a) partial recombinant protein with GST tag.
Sequence
TFNSSQLQALERVFERTHYPDAFVREELARRVNLSEARVQVWFQNRRAKFRRNERAMLASRSASLLKSYSQEAAIEQPVAPRPTALSPDYLSW
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96); Rat (97)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.34 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — PRRX2
Entrez GeneID
51450GeneBank Accession#
NM_016307Protein Accession#
NP_057391Gene Name
PRRX2
Gene Alias
MGC19843, PMX2, PRX2
Gene Description
paired related homeobox 2
Omim ID
604675Gene Ontology
HyperlinkGene Summary
The DNA-associated protein encoded by this gene is a member of the paired family of homeobox proteins. Expression is localized to proliferating fetal fibroblasts and the developing dermal layer, with downregulated expression in adult skin. Increases in expression of this gene during fetal but not adult wound healing suggest a possible role in mechanisms that control mammalian dermal regeneration and prevent formation of scar response to wounding. The expression patterns provide evidence consistent with a role in fetal skin development and a possible role in cellular proliferation. [provided by RefSeq
Other Designations
OTTHUMP00000022344|paired mesoderm homeobox protein 2|paired-like homeodomain protein PRX2|predicted NUP98/PRRX2 fusion protein
-
Disease
-
Publication Reference
-
Expression studies of neuronatin in prenatal and postnatal rat pituitary.
Kanno N, Higuchi M, Yoshida S, Yako H, Chen M, Ueharu H, Nishimura N, Kato T, Kato Y.
Cell and Tissue Research 2016 May; 364(2):273.
Application：IHC-Fr, Rat, Rat embryonic pituitaries.
-
Paired-related homeodomain proteins Prx1 and Prx2 are expressed in embryonic pituitary stem/progenitor cells and may be involved in the early stage of pituitary differentiation.
Susa T, Kato T, Yoshida S, Yako H, Higuchi M, Kato Y.
Journal of Neuroendocrinology 2012 Sep; 24(9):1201.
Application：WB-Re, Recombinant protein.
-
Expression studies of neuronatin in prenatal and postnatal rat pituitary.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com