IHPK2 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human IHPK2 full-length ORF ( AAH65533.1, 1 a.a. - 426 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MSPAFRAMDVEPRAKGVLLEPFVHQVGGHSCVLRFNETTLCKPLVPREHQFYETLPAEMRKFTPQYKGVVSVRFEEDEDRNLCLIAYPLKGDHGIVDIVDNSDCEPKSKLLRWTTNKKHHVLETEKTPKDWVRQHRKEEKMKSHKLEEEFEWLKKSEVLYYTVEKKWNISSQLKHYNPWSMKCHQQQLQRMKENAKHRNQYKFILLENLTSRYEVPCVLDLKMGTRQHGDDASEEKAANQIRKCQQSTSAVIGVRVCGMQVYQAGSGQLMFMNKYHGRKLSVQGFKEALFQFFHNGRYLRRELLGPVLKKLTELKAVLERQESYRFYSSSLLVIYDGKERPEVVLDSDAEDLEDLSEESADESAGAYAYKPIGASSVDVRMIDFAHTTCRLYGEDTVVHEGQDAGYIFGLQSLIDIVTEISEESGE
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
75.7
Interspecies Antigen Sequence
Mouse (92); Rat (96)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — IP6K2
Entrez GeneID
51447GeneBank Accession#
BC065533.1Protein Accession#
AAH65533.1Gene Name
IP6K2
Gene Alias
IHPK2, PiUS
Gene Description
inositol hexakisphosphate kinase 2
Omim ID
606992Gene Ontology
HyperlinkGene Summary
This gene encodes a protein that belongs to the inositol phosphokinase (IPK) family. This protein is likely responsible for the conversion of inositol hexakisphosphate (InsP6) to diphosphoinositol pentakisphosphate (InsP7/PP-InsP5). It may also convert 1,3,4,5,6-pentakisphosphate (InsP5) to PP-InsP4 and affect the growth suppressive and apoptotic activities of interferon-beta in some ovarian cancers. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
ATP:1D-myo-inositol-hexakisphosphate phosphotransferase|OTTHUMP00000164824|Pi uptake stimulator|inositol hexaphosphate kinase 2|insP6 kinase 2
-
Interactome
-
Publication Reference
-
Macrocycles that inhibit the binding between heat shock protein 90 and TPR-containing proteins.
Ardi V, Alexander LD, Johnson VA, McAlpine SR.
ACS Chemical Biology 2011 Dec; 6(12):1357.
Application:Func, PI, Recombinant proteins.
-
Macrocycles that inhibit the binding between heat shock protein 90 and TPR-containing proteins.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com