SCARA3 monoclonal antibody (M01), clone 3A2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
SCARA3 monoclonal antibody (M01), clone 3A2. Western Blot analysis of SCARA3 expression in HepG2 ( Cat # L019V1 ).
Western Blot (Cell lysate)
SCARA3 monoclonal antibody (M01), clone 3A2. Western Blot analysis of SCARA3 expression in PC-12(Cat # L012V1 ).
Western Blot (Cell lysate)
SCARA3 monoclonal antibody (M01), clone 3A2 Western Blot analysis of SCARA3 expression in NIH/3T3 ( Cat # L018V1 ).
Western Blot (Cell lysate)
SCARA3 monoclonal antibody (M01), clone 3A2 Western Blot analysis of SCARA3 expression in IMR-32 ( Cat # L008V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SCARA3 is approximately 3ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SCARA3.
Immunogen
SCARA3 (NP_057324, 316 a.a. ~ 415 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SFLDDHEENMHDLQYHTHYAQNRTVERFESLEGRMASHEIEIGTIFTNINATDNHVHSMLKYLDDVRLSCTLGFHTHAEELYYLNKSVSIMLGTTDLLRE
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SCARA3 monoclonal antibody (M01), clone 3A2. Western Blot analysis of SCARA3 expression in HepG2 ( Cat # L019V1 ).Western Blot (Cell lysate)
SCARA3 monoclonal antibody (M01), clone 3A2. Western Blot analysis of SCARA3 expression in PC-12(Cat # L012V1 ).Western Blot (Cell lysate)
SCARA3 monoclonal antibody (M01), clone 3A2 Western Blot analysis of SCARA3 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
SCARA3 monoclonal antibody (M01), clone 3A2 Western Blot analysis of SCARA3 expression in IMR-32 ( Cat # L008V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SCARA3 is approximately 3ng/ml as a capture antibody.ELISA
-
Gene Info — SCARA3
Entrez GeneID
51435GeneBank Accession#
NM_016240Protein Accession#
NP_057324Gene Name
SCARA3
Gene Alias
APC7, CSR, CSR1, MSLR1, MSRL1
Gene Description
scavenger receptor class A, member 3
Omim ID
602728Gene Ontology
HyperlinkGene Summary
This gene encodes a macrophage scavenger receptor-like protein. This protein has been shown to deplete reactive oxygen species, and thus play an important role in protecting cells from oxidative stress. The expression of this gene is induced by oxidative stress. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq
Other Designations
anaphase promoting complex subunit 7|cellular stress response protein|macrophage scavenger receptor-like 1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com