DDX41 monoclonal antibody (M01), clone 2F4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant DDX41.
Immunogen
DDX41 (NP_057306, 523 a.a. ~ 622 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TGRSGNTGIATTFINKACDESVLMDLKALLLEAKQKVPPVLQVLHCGDESMLDIGGERGCAFCGGLGHRITDCPKLEAMQTKQVSNIGRKDYLAHSSMDF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
DDX41 monoclonal antibody (M01), clone 2F4. Western Blot analysis of DDX41 expression in HeLa.Western Blot (Transfected lysate)
Western Blot analysis of DDX41 expression in transfected 293T cell line by DDX41 monoclonal antibody (M01), clone 2F4.
Lane 1: DDX41 transfected lysate(70 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DDX41 is approximately 0.3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to DDX41 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — DDX41
Entrez GeneID
51428GeneBank Accession#
NM_016222Protein Accession#
NP_057306Gene Name
DDX41
Gene Alias
ABS, MGC8828
Gene Description
DEAD (Asp-Glu-Ala-Asp) box polypeptide 41
Omim ID
608170Gene Ontology
HyperlinkGene Summary
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a member of this family. The function of this member has not been determined. Based on studies in Drosophila, the abstrakt gene is widely required during post-transcriptional gene expression. [provided by RefSeq
Other Designations
2900024F02Rik|DEAD-box protein abstrakt|putative RNA helicase
-
Interactome
-
Publication Reference
-
High-Throughput Screening to Identify Inhibitors of DEAD Box Helicase DDX41.
Yoneyama-Hirozane M, Kondo M, Matsumoto SI, Morikawa-Oki A, Morishita D, Nakanishi A, Kawamoto T, Nakayama M.
Amino Acids 2017 Apr; 2472555217705952.
Application:WB-Re, Recombinant protein.
-
Structural and Functional Analysis of DDX41: a bispecific immune receptor for DNA and cyclic dinucleotide.
Omura H, Oikawa D, Nakane T, Kato M, Ishii R, Ishitani R, Tokunaga F, Nureki O.
Scientific Reports 2016 Oct; 6:34756.
Application:WB-Tr, Human, Human monocyte THP1 cells.
-
High-Throughput Screening to Identify Inhibitors of DEAD Box Helicase DDX41.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com