Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ANGPT4 polyclonal antibody (A01)

  • Catalog # : H00051378-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant ANGPT4.
  • Immunogen:
  • ANGPT4 (NP_057069, 25 a.a. ~ 111 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • TRQEADRGCETLVVQHGHCSYTFLLPKSEPCPPGPEVSRDSNTLQRESLANPLHLGKLPTQQVKQLEQALQNNTQWLKKLERAIKTI
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00051378-A01
    Western Blot detection against Immunogen (35.68 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • ANGPT4
  • Gene Alias:
  • AGP4,ANG-3,ANG4,MGC138181,MGC138183
  • Gene Description:
  • angiopoietin 4
  • Gene Summary:
  • Angiopoietins are proteins with important roles in vascular development and angiogenesis. All angiopoietins bind with similar affinity to an endothelial cell-specific tyrosine-protein kinase receptor. The mechanism by which they contribute to angiogenesis is thought to involve regulation of endothelial cell interactions with supporting perivascular cells. The protein encoded by this gene functions as an agonist and is an angiopoietin. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000029947,angiopoietin-3,dJ824F16.2 (angiopoietin 4)
  • RSS
  • YouTube
  • Linkedin
  • Facebook