UCHL5 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human UCHL5 full-length ORF ( AAH15521, 1 a.a. - 328 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEPMDTDQGNSMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKQNAKKAQETK
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
61.71
Interspecies Antigen Sequence
Mouse (97); Rat (97)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — UCHL5
Entrez GeneID
51377GeneBank Accession#
BC015521.1Protein Accession#
AAH15521Gene Name
UCHL5
Gene Alias
CGI-70, INO80R, UCH37
Gene Description
ubiquitin carboxyl-terminal hydrolase L5
Omim ID
610667Gene Ontology
HyperlinkOther Designations
INO80 complex subunit R|OTTHUMP00000033565|ubiquitin C-terminal hydrolase UCH37|ubiquitin carboxyl-terminal esterase L5
-
Interactome
-
Publication Reference
-
Systematic characterization of deubiquitylating enzymes for roles in maintaining genome integrity.
Nishi R, Wijnhoven P, le Sage C, Tjeertes J, Galanty Y, Forment JV, Clague MJ, Urbe S, Jackson SP.
Nature Cell Biology 2014 Oct; 16(10):1016.
Application:Func, Human, U2OS cells.
-
Systematic characterization of deubiquitylating enzymes for roles in maintaining genome integrity.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com