Product Browser

Last updated: 2017/6/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SNX7 polyclonal antibody (A01)

  • Catalog # : H00051375-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant SNX7.
  • Immunogen:
  • SNX7 (NP_057060, 120 a.a. ~ 226 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • ALHKFLNRIADHPTLTFNEDFKIFLTAQAWELSPHKKQGPGLLSRMGQTVRAVASSMRGVKNRPEEFMEMNNFIELFSQKINLIDKISQRIYKEEREYFDEMKEYGP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Gene Name:
  • SNX7
  • Gene Alias:
  • DKFZp564F052,MGC8717
  • Gene Description:
  • sorting nexin 7
  • Gene Summary:
  • This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region like some family members, and its function is unknown. This gene results in two transcript variants encoding two distinct isoforms. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000012432,OTTHUMP00000012433
  • RSS
  • YouTube
  • Linkedin
  • Facebook