Product Browser

Last updated: 2017/4/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

C2orf28 (Human) Recombinant Protein (P01)

  • Catalog # : H00051374-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human C2orf28 full-length ORF ( AAH11006, 1 a.a. - 171 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MLHARCCLNQKGTILGLDLQNCSLEDPGPNFHQAHTTVIIDLQANPLKGDLANTFRGFTQLQTLILPQHVNCPGGINAWNTITSYIDNQICQGQKNLCNNTGDPEMCPENGSCVPDGPGLLQCVCADGFHGYKCMRQGSFSLLMFFGILGATTLSVSILLWATQRRKAKTS
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 44.55
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00051374-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • C2orf28
  • Gene Alias:
  • APR--3,APR-3,APR3,HSPC013,PRO240,p18
  • Gene Description:
  • chromosome 2 open reading frame 28
  • Gene Summary:
  • This gene is thought to be involved in apoptosis, and may also be involved in hematopoietic development and differentiation. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000158506,apoptosis related protein 3,apoptosis related protein APR-3
  • RSS
  • YouTube
  • Linkedin
  • Facebook