C2orf28 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
C2orf28 MaxPab polyclonal antibody. Western Blot analysis of C2orf28 expression in human kidney.
Western Blot (Transfected lysate)
Western Blot analysis of C2orf28 expression in transfected 293T cell line (H00051374-T02) by C2orf28 MaxPab polyclonal antibody.
Lane 1: C2orf28 transfected lysate(18.81 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human C2orf28 protein.
Immunogen
C2orf28 (NP_057169.2, 1 a.a. ~ 171 a.a) full-length human protein.
Sequence
MLHARCCLNQKGTILGLDLQNCSLEDPGPNFHQAHTTVIIDLQANPLKGDLANTFRGFTQLQTLILPQHVNCPGGINAWNTITSYIDNQICQGQKNLCNNTGDPEMCPENGSCVPDGPGLLQCVCADGFHGYKCMRQGSFSLLMFFGILGATTLSVSILLWATQRRKAKTS
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
C2orf28 MaxPab polyclonal antibody. Western Blot analysis of C2orf28 expression in human kidney.Western Blot (Transfected lysate)
Western Blot analysis of C2orf28 expression in transfected 293T cell line (H00051374-T02) by C2orf28 MaxPab polyclonal antibody.
Lane 1: C2orf28 transfected lysate(18.81 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — C2orf28
Entrez GeneID
51374GeneBank Accession#
NM_016085Protein Accession#
NP_057169.2Gene Name
C2orf28
Gene Alias
APR--3, APR-3, APR3, HSPC013, PRO240, p18
Gene Description
chromosome 2 open reading frame 28
Gene Ontology
HyperlinkGene Summary
This gene is thought to be involved in apoptosis, and may also be involved in hematopoietic development and differentiation. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000158506|apoptosis related protein 3|apoptosis related protein APR-3
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com