Product Browser

Last updated: 2017/5/28
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

POMP purified MaxPab mouse polyclonal antibody (B02P)MaxPab

  • Catalog # : H00051371-B02P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human POMP protein.
  • Immunogen:
  • POMP (NP_057016.1, 1 a.a. ~ 141 a.a) full-length human protein.
  • Sequence:
  • MNARGLGSELKDSIPVTELSASGPFESHDLLRKGFSCVKNELLPSHPLELSEKNFQLNQDKMNFSTLRNIQGLFAPLKLQMEFKAVQQVQRLPFLSSSNLSLDVLRGNDETIGFEDILNDPSQSEVMGEPHLMVEYKLGLL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of POMP expression in transfected 293T cell line (H00051371-T03) by POMP MaxPab polyclonal antibody.

    Lane 1: POMP transfected lysate(15.8 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • POMP
  • Gene Alias:
  • C13orf12,HSPC014,PNAS-110,UMP1
  • Gene Description:
  • proteasome maturation protein
  • Other Designations:
  • 2510048O06Rik,OTTHUMP00000018185,proteassemblin,voltage-gated potassium channel beta subunit 4.1
  • Gene Pathway
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook