ZMYND10 monoclonal antibody (M24), clone 3D11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of ZMYND10 expression in transfected 293T cell line by ZMYND10 monoclonal antibody (M24), clone 3D11.
Lane 1: ZMYND10 transfected lysate (Predicted MW: 50.3 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ZMYND10 is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ZMYND10.
Immunogen
ZMYND10 (NP_056980.2, 341 a.a. ~ 440 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LERENRGKWQAIAKHQLQHVFSPSEQDLWLQARRWAETYRLDVLEAVAPERPRCAYCSAEASKRCSRCQNEWYCCRECQVKHWEKHGKTCVLAAQGDRAK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (88); Rat (88)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ZMYND10 expression in transfected 293T cell line by ZMYND10 monoclonal antibody (M24), clone 3D11.
Lane 1: ZMYND10 transfected lysate (Predicted MW: 50.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ZMYND10 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — ZMYND10
Entrez GeneID
51364GeneBank Accession#
NM_015896Protein Accession#
NP_056980.2Gene Name
ZMYND10
Gene Alias
BLU, FLU
Gene Description
zinc finger, MYND-type containing 10
Omim ID
607070Gene Ontology
HyperlinkGene Summary
O
Other Designations
zinc finger, MYND domain containing 10|zinc finger, MYND domain-containing 10
-
Interactome
-
Publication Reference
-
ZMYND10 is mutated in primary ciliary dyskinesia and interacts with LRRC6.
Maimoona A Zariwala, Heon Yung Gee, Małgorzata Kurkowiak, Dalal A Al-Mutairi, Margaret W Leigh, Toby W Hurd, Rim Hjeij, Sharon D Dell, Moumita Chaki, Gerard W Dougherty, Mohamed Adan, Philip C Spear, Julian Esteve-Rudd, Niki T Loges, Margaret Rosenfeld, Katrina A Diaz, Heike Olbrich, Whitney E Wolf, Eamonn Sheridan, Trevor F C Batten, Jan Halbritter, Jonathan D Porath, Stefan Kohl, Svjetlana Lovric, Daw-Yang Hwang, Jessica E Pittman, Kimberlie A Burns, Thomas W Ferkol, Scott D Sagel, Kenneth N O
American Journal of Human Genetics 2013 Jul; 93(2):336.
Application：Immunofluorescence, Rat, Rat trachea.
-
ZMYND10 is mutated in primary ciliary dyskinesia and interacts with LRRC6.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com