Product Browser

Last updated: 2017/4/30
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

KLRF1 polyclonal antibody (A01)

  • Catalog # : H00051348-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant KLRF1.
  • Immunogen:
  • KLRF1 (NP_057607, 69 a.a. ~ 166 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • KCQKGSCSNATQYEDTGDLKVNNGTRRNISNKDLCASRSADQTVLCQSEWLKYQGKCYWFSNEMKSWSDSYVYCLERKSHLLIIHDQLEMAFIQKNLR
  • Host:
  • Mouse
  • Reactivity:
  • Human, Mouse
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00051348-A01
    Western Blot detection against Immunogen (36.89 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • KLRF1 polyclonal antibody (A01), Lot # 051214JC01. Western Blot analysis of KLRF1 expression in NIH/3T3. (Isoform : 9.028 kDa)
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • KLRF1
  • Gene Alias:
  • CLEC5C,MGC119907,MGC119908,MGC119909
  • Gene Description:
  • killer cell lectin-like receptor subfamily F, member 1
  • Other Designations:
  • killer cell lectin-like receptor F1,lectin-like receptor F1
  • RSS
  • YouTube
  • Linkedin
  • Facebook