Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ERAF polyclonal antibody (A01)

  • Catalog # : H00051327-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant ERAF.
  • Immunogen:
  • ERAF (NP_057717, 1 a.a. ~ 102 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKSHELPSHPPPSS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00051327-A01
    Western Blot detection against Immunogen (37.33 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of ERAF expression in transfected 293T cell line by ERAF polyclonal antibody (A01).

    Lane1:ERAF transfected lysate(11.84 KDa).
    Lane2:Non-transfected lysate.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • ERAF
  • Gene Alias:
  • AHSP,EDRF
  • Gene Description:
  • erythroid associated factor
  • Other Designations:
  • alpha hemoglobin stabilising protein,erythroid differentiation associated factor,erythroid differentiation-related factor
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook