Product Browser

Last updated: 2017/12/10

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SPG21 (Human) Recombinant Protein (Q01)

  • Catalog # : H00051324-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SPG21 partial ORF ( NP_057714, 211 a.a. - 306 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • PHKIRDIPVTIMDVFDQSALSTEAKEEMYKLYPNARRAHLKTGGNFPYLCRSAEVNLYVQIHLLQFHGTKYAAIDPSMVSAEELEVQKGSLGISQE
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.3
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00051324-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • SPG21
  • Gene Alias:
  • ACP33,BM-019,GL010,MASPARDIN,MAST
  • Gene Description:
  • spastic paraplegia 21 (autosomal recessive, Mast syndrome)
  • Gene Summary:
  • The protein encoded by this gene was identified by a two-hybrid screen using CD4 as the bait. It binds to the hydrophobic C-terminal amino acids of CD4 which are involved in repression of T cell activation. The interaction with CD4 is mediated by the noncatalytic alpha/beta hydrolase fold domain of this protein. It is thus proposed that this gene product modulates the stimulatory activity of CD4. At least three different transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • acid cluster protein 33,spastic paraplegia 21
  • RSS
  • YouTube
  • Linkedin
  • Facebook