Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SPG21 polyclonal antibody (A01)

  • Catalog # : H00051324-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant SPG21.
  • Immunogen:
  • SPG21 (NP_057714, 211 a.a. ~ 306 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • PHKIRDIPVTIMDVFDQSALSTEAKEEMYKLYPNARRAHLKTGGNFPYLCRSAEVNLYVQIHLLQFHGTKYAAIDPSMVSAEELEVQKGSLGISQE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00051324-A01
    Western Blot detection against Immunogen (36.67 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • SPG21 polyclonal antibody (A01), Lot # 060516JCS1 Western Blot analysis of SPG21 expression in HL-60 ( Cat # L014V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • SPG21
  • Gene Alias:
  • ACP33,BM-019,GL010,MASPARDIN,MAST
  • Gene Description:
  • spastic paraplegia 21 (autosomal recessive, Mast syndrome)
  • Gene Summary:
  • The protein encoded by this gene was identified by a two-hybrid screen using CD4 as the bait. It binds to the hydrophobic C-terminal amino acids of CD4 which are involved in repression of T cell activation. The interaction with CD4 is mediated by the noncatalytic alpha/beta hydrolase fold domain of this protein. It is thus proposed that this gene product modulates the stimulatory activity of CD4. At least three different transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • acid cluster protein 33,spastic paraplegia 21
  • RSS
  • YouTube
  • Linkedin
  • Facebook