Product Browser

Last updated: 2017/5/21

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TXNDC3 monoclonal antibody (M01), clone 1G5

  • Catalog # : H00051314-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant TXNDC3.
  • Immunogen:
  • TXNDC3 (NP_057700, 530 a.a. ~ 586 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • AEWRRLMGPTDPEEAKLLSPDSIRAQFGISKLKNIVHGASNAYEAKEVVNRLFEDPE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00051314-M01
    Western Blot detection against Immunogen (32.01 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • TXNDC3 monoclonal antibody (M01), clone 1G5. Western Blot analysis of TXNDC3 expression in Jurkat ( Cat # L017V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • TXNDC3
  • Gene Alias:
  • CILD6,NME8,SPTRX2
  • Gene Description:
  • thioredoxin domain containing 3 (spermatozoa)
  • Gene Summary:
  • TXNDC3 encodes a group II thioredoxin protein, composed of a thioredoxin domain and 3 NDP kinase domains, with testis-specific expression.[supplied by OMIM
  • Other Designations:
  • NM23-H8,OTTHUMP00000025334,sperm-specific thioredoxin 2,thioredoxin domain containing 3,thioredoxin domain-containing 3 (spermatozoa)
  • RSS
  • YouTube
  • Linkedin
  • Facebook