TLR8 monoclonal antibody (M01), clone 4C6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TLR8.
Immunogen
TLR8 (NP_619542, 723 a.a. ~ 825 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RISHLPSGFLSEVSSLKHLDLSSNLLKTINKSALETKTTTKLSMLELHGNPFECTCDIGDFRRWMDEHLNVKIPRLVDVICASPGDQRGKSIVSLELTTCVSD
Host
Mouse
Reactivity
Human
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.33 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TLR8 monoclonal antibody (M01), clone 4C6 Western Blot analysis of TLR8 expression in HL-60 ( Cat # L014V1 ).Western Blot (Transfected lysate)
Western Blot analysis of TLR8 expression in transfected 293T cell line by TLR8 monoclonal antibody (M01), clone 4C6.
Lane 1: TLR8 transfected lysate(121.764 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
-
Gene Info — TLR8
Entrez GeneID
51311GeneBank Accession#
NM_138636Protein Accession#
NP_619542Gene Name
TLR8
Gene Alias
CD288, MGC119599, MGC119600
Gene Description
toll-like receptor 8
Omim ID
300366Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is predominantly expressed in lung and peripheral blood leukocytes, and lies in close proximity to another family member, TLR7, on chromosome X. [provided by RefSeq
Other Designations
OTTHUMP00000022930
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Phagosomal signaling by Borrelia burgdorferi in human monocytes involves Toll-like receptor (TLR) 2 and TLR8 cooperativity and TLR8-mediated induction of IFN-{beta}.
Cervantes JL, Dunham-Ems SM, La Vake CJ, Petzke MM, Sahay B, Sellati TJ, Radolf JD, Salazar JC.
Proceedings of the National Academy of Sciences of the United States of America 2011 Mar; 108(9):3683.
Application:WB, Human, Monocyte.
-
Phagosomal signaling by Borrelia burgdorferi in human monocytes involves Toll-like receptor (TLR) 2 and TLR8 cooperativity and TLR8-mediated induction of IFN-{beta}.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com