ARMCX1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human ARMCX1 partial ORF ( NP_057692, 188 a.a. - 295 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
RRGKFNFPYKIDDILSAPDLQKVLNILERTNDPFIQEVALVTLGNNAAYSFNQNAIRELGGVPIIAKLIKTKDPIIREKTYNALNNLSVNAENQGKIKTYISQVCDDT
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.62
Interspecies Antigen Sequence
Mouse (84)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — ARMCX1
Entrez GeneID
51309GeneBank Accession#
NM_016608Protein Accession#
NP_057692Gene Name
ARMCX1
Gene Alias
ALEX1, DKFZp686P06199
Gene Description
armadillo repeat containing, X-linked 1
Omim ID
300362Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the ALEX family of proteins and may play a role in tumor suppression. The encoded protein contains a potential N-terminal transmembrane domain and two Armadillo (arm) repeats. Other proteins containing the arm repeat are involved in development, maintenance of tissue integrity, and tumorigenesis. This gene is closely localized with other family members, including ALEX2 and ALEX3, on the X chromosome. [provided by RefSeq
Other Designations
OTTHUMP00000023686|arm protein lost in epithelial cancers, X chromosome, 1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com