ARMCX1 monoclonal antibody (M01), clone 6E10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant ARMCX1.
Immunogen
ARMCX1 (NP_057692, 188 a.a. ~ 295 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RRGKFNFPYKIDDILSAPDLQKVLNILERTNDPFIQEVALVTLGNNAAYSFNQNAIRELGGVPIIAKLIKTKDPIIREKTYNALNNLSVNAENQGKIKTYISQVCDDT
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (84)
Isotype
IgG3 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.62 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ARMCX1 expression in transfected 293T cell line by ARMCX1 monoclonal antibody (M01), clone 6E10.
Lane 1: ARMCX1 transfected lysate (Predicted MW: 49.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ARMCX1 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — ARMCX1
Entrez GeneID
51309GeneBank Accession#
NM_016608Protein Accession#
NP_057692Gene Name
ARMCX1
Gene Alias
ALEX1, DKFZp686P06199
Gene Description
armadillo repeat containing, X-linked 1
Omim ID
300362Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the ALEX family of proteins and may play a role in tumor suppression. The encoded protein contains a potential N-terminal transmembrane domain and two Armadillo (arm) repeats. Other proteins containing the arm repeat are involved in development, maintenance of tissue integrity, and tumorigenesis. This gene is closely localized with other family members, including ALEX2 and ALEX3, on the X chromosome. [provided by RefSeq
Other Designations
OTTHUMP00000023686|arm protein lost in epithelial cancers, X chromosome, 1
-
Interactomes
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com