BFAR monoclonal antibody (M01), clone 1C6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of BFAR expression in transfected 293T cell line by BFAR monoclonal antibody (M01), clone 1C6.
Lane 1: BFAR transfected lysate(52.7 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to BFAR on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
RNAi Knockdown (Antibody validated)
Western blot analysis of BFAR over-expressed 293 cell line, cotransfected with BFAR Validated Chimera RNAi ( Cat # H00051283-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with BFAR monoclonal antibody (M01), clone 1C6 (Cat # H00051283-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant BFAR.
Immunogen
BFAR (AAH03054, 101 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LRFEDIQQNNDIVQSLAAFQKYGNDQIPLAPNTGRANQQMGGGFFSGVLTALTGVAVVLLVYHWSSRESEHDLLVHKAVAKWTAEEVVLWLEQLGPWASL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (90); Rat (90)
Isotype
IgG2a kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of BFAR expression in transfected 293T cell line by BFAR monoclonal antibody (M01), clone 1C6.
Lane 1: BFAR transfected lysate(52.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to BFAR on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of BFAR over-expressed 293 cell line, cotransfected with BFAR Validated Chimera RNAi ( Cat # H00051283-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with BFAR monoclonal antibody (M01), clone 1C6 (Cat # H00051283-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — BFAR
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com