Product Browser

Last updated: 2016/11/27
  • Related Product Showcase
  • By Disease

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IER5 polyclonal antibody (A01)

  • Catalog # : H00051278-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant IER5.
  • Immunogen:
  • IER5 (NP_057629, 1 a.a. ~ 56 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MEFKLEAHRIVSISLGKIYNSRVQRGGIKLHKNLLVSLVLRSARQVYLSDPCPGLY
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00051278-A01
    Western Blot detection against Immunogen (32.27 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • IER5
  • Gene Alias:
  • MGC102760,SBBI48
  • Gene Description:
  • immediate early response 5
  • Gene Summary:
  • This gene encodes a protein that is similar to other immediate early response proteins. In the mouse, a similar gene may play an important role in mediating the cellular response to mitogenic signals. Studies in rats found the expression of a similar gene to be increased after waking and sleep deprivation. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000033133
  • RSS
  • YouTube
  • Linkedin
  • Facebook