RNF181 monoclonal antibody (M01), clone 5A7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
RNF181 monoclonal antibody (M01), clone 5A7 Western Blot analysis of RNF181 expression in Jurkat ( Cat # L017V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of RNF181 expression in transfected 293T cell line by RNF181 monoclonal antibody (M01), clone 5A7.
Lane 1: RNF181 transfected lysate(17.9 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of RNF181 transfected lysate using anti-RNF181 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with RNF181 monoclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RNF181 is approximately 0.1ng/ml as a capture antibody.
Western Blot detection against Immunogen (32.78 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RNF181.
Immunogen
RNF181 (NP_057578, 90 a.a. ~ 153 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
IEMPCHHLFHSSCILPWLSKTNSCPLCRYELPTDDDTYEEHRRDKARKQQQQHRLENLHGAMYT
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (78); Rat (81)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (32.78 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RNF181 monoclonal antibody (M01), clone 5A7 Western Blot analysis of RNF181 expression in Jurkat ( Cat # L017V1 ).Western Blot (Transfected lysate)
Western Blot analysis of RNF181 expression in transfected 293T cell line by RNF181 monoclonal antibody (M01), clone 5A7.
Lane 1: RNF181 transfected lysate(17.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of RNF181 transfected lysate using anti-RNF181 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with RNF181 monoclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RNF181 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — RNF181
Entrez GeneID
51255GeneBank Accession#
NM_016494Protein Accession#
NP_057578Gene Name
RNF181
Gene Alias
HSPC238
Gene Description
ring finger protein 181
Gene Ontology
HyperlinkGene Summary
RNF181 binds the integrin alpha-IIb (ITGA2B; MIM 607759)/beta-3 (ITGB3; MIM 173470) complex and has E3 ubiquitin ligase activity (Brophy et al., 2008 [PubMed 18331836]).[supplied by OMIM
Other Designations
-
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com