Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RNF181 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00051255-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human RNF181 protein.
  • Immunogen:
  • RNF181 (NP_057578.1, 1 a.a. ~ 153 a.a) full-length human protein.
  • Sequence:
  • MASYFDEHDCEPSDPEQETRTNMLLELARSLFNRMDFEDLGLVVDWDHHLPPPAAKTVVENLPRTVIRGSQAELKCPVCLLEFEEEETAIEMPCHHLFHSSCILPWLSKTNSCPLCRYELPTDDDTYEEHRRDKARKQQQQHRLENLHGAMYT
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse
  • Quality Control Testing:
  • Antibody reactive against mammalian tissue lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • RNF181 MaxPab rabbit polyclonal antibody. Western Blot analysis of RNF181 expression in human kidney.
  • PDF DownloadProtocol Download
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • RNF181 MaxPab rabbit polyclonal antibody. Western Blot analysis of RNF181 expression in human spleen.
  • PDF DownloadProtocol Download
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • RNF181 MaxPab rabbit polyclonal antibody. Western Blot analysis of RNF181 expression in mouse kidney.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • RNF181
  • Gene Alias:
  • HSPC238
  • Gene Description:
  • ring finger protein 181
  • Gene Summary:
  • RNF181 binds the integrin alpha-IIb (ITGA2B; MIM 607759)/beta-3 (ITGB3; MIM 173470) complex and has E3 ubiquitin ligase activity (Brophy et al., 2008 [PubMed 18331836]).[supplied by OMIM
  • Other Designations:
  • -
  • RSS
  • YouTube
  • Linkedin
  • Facebook