RNF181 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
RNF181 MaxPab rabbit polyclonal antibody. Western Blot analysis of RNF181 expression in human kidney.
Western Blot (Tissue lysate)
RNF181 MaxPab rabbit polyclonal antibody. Western Blot analysis of RNF181 expression in mouse kidney.
Western Blot (Tissue lysate)
RNF181 MaxPab rabbit polyclonal antibody. Western Blot analysis of RNF181 expression in human spleen.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human RNF181 protein.
Immunogen
RNF181 (NP_057578.1, 1 a.a. ~ 153 a.a) full-length human protein.
Sequence
MASYFDEHDCEPSDPEQETRTNMLLELARSLFNRMDFEDLGLVVDWDHHLPPPAAKTVVENLPRTVIRGSQAELKCPVCLLEFEEEETAIEMPCHHLFHSSCILPWLSKTNSCPLCRYELPTDDDTYEEHRRDKARKQQQQHRLENLHGAMYT
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (78); Rat (81)
Quality Control Testing
Antibody reactive against mammalian tissue lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
RNF181 MaxPab rabbit polyclonal antibody. Western Blot analysis of RNF181 expression in human kidney.Western Blot (Tissue lysate)
RNF181 MaxPab rabbit polyclonal antibody. Western Blot analysis of RNF181 expression in mouse kidney.Western Blot (Tissue lysate)
RNF181 MaxPab rabbit polyclonal antibody. Western Blot analysis of RNF181 expression in human spleen. -
Gene Info — RNF181
Entrez GeneID
51255GeneBank Accession#
NM_016494.3Protein Accession#
NP_057578.1Gene Name
RNF181
Gene Alias
HSPC238
Gene Description
ring finger protein 181
Gene Ontology
HyperlinkGene Summary
RNF181 binds the integrin alpha-IIb (ITGA2B; MIM 607759)/beta-3 (ITGB3; MIM 173470) complex and has E3 ubiquitin ligase activity (Brophy et al., 2008 [PubMed 18331836]).[supplied by OMIM
Other Designations
-
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com