Product Browser

Last updated: 2017/1/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NT5C3 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00051251-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human NT5C3 protein.
  • Immunogen:
  • NT5C3 (AAH15856, 1 a.a. ~ 286 a.a) full-length human protein.
  • Sequence:
  • MMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNIIDNCKLVTDECRKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDVMLKEGYENFFDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVQDESLEVANSILQKIL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of NT5C3 expression in transfected 293T cell line (H00051251-T01) by NT5C3 MaxPab polyclonal antibody.

    Lane 1: NT5C3 transfected lysate(31.57 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • NT5C3
  • Gene Alias:
  • MGC27337,MGC87109,MGC87828,P5'N-1,PN-I,PSN1,UMPH,UMPH1,cN-III
  • Gene Description:
  • 5'-nucleotidase, cytosolic III
  • Gene Summary:
  • Pyrimidine 5-prime-nucleotidase (P5N; EC 3.1.3.5), also called uridine 5-prime monophosphate hydrolase (UMPH), catalyzes the dephosphorylation of the pyrimidine 5-prime monophosphates UMP and CMP to the corresponding nucleosides. There are 2 isozymes of pyrimidine 5-prime nucleotidase in red blood cells, referred to as type I (UMPH1) and type II (UMPH2; MIM 191720). The 2 enzymes are not separable by electrophoresis in humans but have distinct kinetic properties, and the proteins show no homology.[supplied by OMIM
  • Other Designations:
  • pyrimidine 5'-nucleotidase,uridine 5' monophosphate hydrolase 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook