Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PIGP (Human) Recombinant Protein (P01)

  • Catalog # : H00051227-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PIGP full-length ORF ( AAH05180, 1 a.a. - 134 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MVENSPSPLPERAIYGFVLFLSSQFGFILYLVWAFIPESWLNSLGLTYWPQKYWAVALPVYLLIAIVIGYVLLFGINMMSTSPLDSIHTITDNYAKNQQQKKYQEEAIPALRDISISEVNQMFFLAAKELYTKN
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 40.37
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00051227-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • PIGP
  • Gene Alias:
  • DCRC,DCRC-S,DSCR5,DSRC
  • Gene Description:
  • phosphatidylinositol glycan anchor biosynthesis, class P
  • Gene Summary:
  • This gene encodes an enzyme involved in the first step of glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells that serves to anchor proteins to the cell surface. The encoded protein is a component of the GPI-N-acetylglucosaminyltransferase complex that catalyzes the transfer of N-acetylglucosamine (GlcNAc) from UDP-GlcNAc to phosphatidylinositol (PI). This gene is located in the Down Syndrome critical region on chromosome 21 and is a candidate for the pathogenesis of Down syndrome. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq
  • Other Designations:
  • Down syndrome critical region gene 5,Down syndrome critical region protein 5,Down syndrome critical region protein C,OTTHUMP00000109076,OTTHUMP00000109079,phosphatidylinositol N-acetylglucosaminyltransferase subunit P,phosphatidylinositol glycan, class P,
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook