Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DUSP13 (Human) Recombinant Protein (P01)

  • Catalog # : H00051207-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human DUSP13 full-length ORF ( AAH09778, 1 a.a. - 198 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MDSLQKQDLRRPKIHGAVQASPYQPPTLASLQRLLWVRQAATLNHIDEVWPSLFLGDAYAARDKSKLIQLGITHVVNAAAGKFQVDTGAKFYRGMSLEYYGIEADDNPFFDLSVYFLPVARYIRAALSVPQGRVLVHCAMGVSRSATLVLAFLMIYENMTLVEAIQTVQAHRNICPNSGFLRQLQVLDNRLGRETGRF
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 47.52
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00051207-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Phosphatase Assay (Cdc25)
  • Phosphatase Assay (PTP)
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Phosphatase Assay (Cdc25)
  • Phosphatase Assay (PTP)
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • DUSP13
  • Gene Alias:
  • BEDP,DUSP13A,DUSP13B,FLJ32450,MDSP,SKRP4,TMDP
  • Gene Description:
  • dual specificity phosphatase 13
  • Gene Summary:
  • Members of the protein-tyrosine phosphatase superfamily cooperate with protein kinases to regulate cell proliferation and differentiation. This superfamily is separated into two families based on the substrate that is dephosphorylated. One family, the dual specificity phosphatases (DSPs) acts on both phosphotyrosine and phosphoserine/threonine residues. This gene encodes different but related DSP proteins through the use of non-overlapping open reading frames, alternate splicing, and presumed different transcription promoters. Expression of the distinct proteins from this gene has been found to be tissue specific and the proteins may be involved in postnatal development of specific tissues. A protein encoded by the upstream ORF was found in skeletal muscle, whereas the encoded protein from the downstream ORF was found only in testis. In mouse, a similar pattern of expression was found. Multiple alternatively spliced transcript variants were described, but the full-length sequence of only some were determined. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000019875,OTTHUMP00000060197,branching-enzyme interacting dual-specificity protein phosphatase,dual-specificity phosphatase SKRP4,muscle-restricted dual specificity phosphatase
  • RSS
  • YouTube
  • Linkedin
  • Facebook