HERC5 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant HERC5.
Immunogen
HERC5 (NP_057407, 915 a.a. ~ 1024 a.a) partial recombinant protein with GST tag.
Sequence
YDWKTFEKNARYEPGYNSSHPTIVMFWKAFHKLTLEEKKKFLVFLTGTDRLQMKDLNNMKITFCCPESWNERDPIRALTCFSVLFLPKYSTMETVEEALQEAINNNRGFG
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.21 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — HERC5
Entrez GeneID
51191GeneBank Accession#
NM_016323Protein Accession#
NP_057407Gene Name
HERC5
Gene Alias
CEB1, CEBP1
Gene Description
hect domain and RLD 5
Omim ID
608242Gene Ontology
HyperlinkGene Summary
This gene is a member of the HERC family of ubiquitin ligases and encodes a protein with a HECT domain and five RCC1 repeats. Pro-inflammatory cytokines upregulate expression of this gene in endothelial cells. The protein localizes to the cytoplasm and perinuclear region and functions as an interferon-induced E3 protein ligase that mediates ISGylation of protein targets. The gene lies in a cluster of HERC family genes on chromosome 4. [provided by RefSeq
Other Designations
HECT E3 ubiquitin ligase|HECT domain and RCC1-like domain-containing protein 5|cyclin-E binding protein 1
-
Interactome
-
Publication Reference
-
Cross-talk between SUMOylation and ISGylation in response to interferon.
El-Asmi F, McManus FP, Brantis-de-Carvalho CE, Valle-Casuso JC, Thibault P, Chelbi-Alix MK.
Cytokine 2020 Feb; 129:155025.
Application:WB, Human, HeLa cell.
-
90K Glycoprotein Promotes Degradation of Mutant β-Catenin Lacking the ISGylation or Phosphorylation Sites in the N-terminus.
Park SY, Yoon S, Kim H, Kim KK.
Neoplasia 2016 Sep; 18(10):618.
Application:WB, Human, HEK 293, HEK 293T, HeLa, CSC221 cells.
-
Covalent ISG15 conjugation positively regulates the ubiquitin E3 ligase activity of parkin.
Im E, Yoo L, Hyun M, Shin WH, Chung KC.
Open Biology 2016 Aug; 6(8):160193.
Application:WB-Tr, Human, HEK293 cells.
-
Interferon-induced HERC5 is evolving under positive selection and inhibits HIV-1 particle production by a novel mechanism targeting Rev/RRE-dependent RNA nuclear export.
Woods MW, Tong JG, Tom SK, Szabo PA, Cavanagh PC, Dikeakos JD, Haeryfar SM, Barr SD.
Retrovirology 2014 Apr; 11:27.
Application:WB-Tr, Human, 293T cells.
-
Human HERC5 restricts an early stage of HIV-1 assembly by a mechanism correlating with the ISGylation of Gag.
Woods MW, Kelly JN, Hattlmann CJ, Tong JG, Xu LS, Coleman MD, Quest GR, Smiley JR, Barr SD.
Retrovirology 2011 Nov; 8:95.
Application:IF, WB-Tr, Human, Mouse, 293T, HeLa, Jurkat, Dendritic cells, PBMCs.
-
Cross-talk between SUMOylation and ISGylation in response to interferon.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com