Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

C15orf15 (Human) Recombinant Protein (P01)

  • Catalog # : H00051187-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human C15orf15 full-length ORF ( AAH05344, 1 a.a. - 150 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MRIEKCYFCSGPIYPGHGMMFVRNDCKVFRFCKSKCHKNFKKKRNPRKVRWTKAFRKAAGKELTVDNSFEFEKRRNEPIKYQRELWNKTIDAMKRVEEIKQKRQAKFIMNRLKKNKELQKVQDIKEVKQNIHLIRAPLAGKGKQLEEKMV
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 42.24
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00051187-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • C15orf15
  • Gene Alias:
  • HRP-L30-iso,L30,RLP24,RPL24,RPL24L,TVAS3
  • Gene Description:
  • chromosome 15 open reading frame 15
  • Gene Summary:
  • This gene encodes a protein sharing a low level of sequence similarity with human ribosomal protein L24. Although this gene has been referred to as RPL24, L30, and 60S ribosomal protein L30 isolog in the sequence databases, it is distinct from the human genes officially named RPL24 (which itself has been referred to as ribosomal protein L30) and RPL30. The function of this gene is currently unknown. This gene utilizes alternative polyadenylation signals. [provided by RefSeq
  • Other Designations:
  • 60S ribosomal protein L30 isolog,homolog of yeast ribosomal like protein 24,my024 protein,ribosomal protein L24-like
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook