C15orf15 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human C15orf15 full-length ORF ( AAH05344, 1 a.a. - 150 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MRIEKCYFCSGPIYPGHGMMFVRNDCKVFRFCKSKCHKNFKKKRNPRKVRWTKAFRKAAGKELTVDNSFEFEKRRNEPIKYQRELWNKTIDAMKRVEEIKQKRQAKFIMNRLKKNKELQKVQDIKEVKQNIHLIRAPLAGKGKQLEEKMV
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
42.24
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — C15orf15
Entrez GeneID
51187GeneBank Accession#
BC005344Protein Accession#
AAH05344Gene Name
C15orf15
Gene Alias
HRP-L30-iso, L30, RLP24, RPL24, RPL24L, TVAS3
Gene Description
chromosome 15 open reading frame 15
Gene Ontology
HyperlinkGene Summary
This gene encodes a protein sharing a low level of sequence similarity with human ribosomal protein L24. Although this gene has been referred to as RPL24, L30, and 60S ribosomal protein L30 isolog in the sequence databases, it is distinct from the human genes officially named RPL24 (which itself has been referred to as ribosomal protein L30) and RPL30. The function of this gene is currently unknown. This gene utilizes alternative polyadenylation signals. [provided by RefSeq
Other Designations
60S ribosomal protein L30 isolog|homolog of yeast ribosomal like protein 24|my024 protein|ribosomal protein L24-like
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com