Product Browser

Last updated: 2017/6/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

WBP5 (Human) Recombinant Protein (P01)

  • Catalog # : H00051186-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human WBP5 full-length ORF ( ABZ92330.1, 1 a.a. - 104 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MKSCQKMEGKPENESEPKHEEEPKPEEKPEEEEKLEEEAKAKGTFRERLIQSLQEFKEDIHNRHLSNEDMFREVDEIDEIRRVRNKLIVMRWKVNRNHPYPYLM
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 11.5
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • WBP5
  • Gene Alias:
  • DKFZp313K1940,TCEAL9
  • Gene Description:
  • WW domain binding protein 5
  • Gene Summary:
  • The globular WW domain is composed of 38 to 40 semiconserved amino acids shared by proteins of diverse functions including structural, regulatory, and signaling proteins. The domain is involved in mediating protein-protein interactions through the binding of polyproline ligands. This gene encodes a WW domain binding protein. This gene also encodes a domain with similarity to the transcription elongation factor A, SII-related family. Alternative splicing results in multiple transcript variants encoding a single isoform. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000023739,OTTHUMP00000023740,WW domain binding protein 1,pp21 homolog
  • RSS
  • YouTube
  • Linkedin
  • Facebook