Product Browser

Last updated: 2017/2/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DCXR polyclonal antibody (A01)

  • Catalog # : H00051181-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant DCXR.
  • Immunogen:
  • DCXR (NP_057370, 145 a.a. ~ 244 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • NHSVYCSTKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWSDPHKAKTMLNRIPLGKFAEVEHVVNAILFLLSDRSGMTTGSTLPVEGGFWAC
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00051181-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • DCXR polyclonal antibody (A01), Lot # 060707JCS1 Western Blot analysis of DCXR expression in A-431 ( Cat # L015V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • DCXR
  • Gene Alias:
  • DCR,HCR2,HCRII,KIDCR,P34H,SDR20C1
  • Gene Description:
  • dicarbonyl/L-xylulose reductase
  • Gene Summary:
  • DCXR is an enzyme that has both diacetyl reductase (EC 1.1.1.5) and L-xylulose reductase (EC 1.1.1.10) activities (Nakagawa et al., 2002 [PubMed 11882650]).[supplied by OMIM
  • Other Designations:
  • carbonyl reductase II,human carbonyl reductase 2,kidney dicarbonyl reductase,short chain dehydrogenase/reductase family 20C, member 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook