Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HSD17B14 (Human) Recombinant Protein (P01)

  • Catalog # : H00051171-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human HSD17B14 full-length ORF ( NP_057330.2, 1 a.a. - 270 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIPS
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 54.7
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00051171-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • HSD17B14
  • Gene Alias:
  • DHRS10,SDR47C1,retSDR3
  • Gene Description:
  • hydroxysteroid (17-beta) dehydrogenase 14
  • Gene Summary:
  • 17-beta-hydroxysteroid dehydrogenases, such as HSD17B14, are primarily involved in metabolism of steroids at the C17 position and also of other substrates, such as fatty acids, prostaglandins, and xenobiotics (Lukacik et al., 2007 [PubMed 17067289]).[supplied by OMIM
  • Other Designations:
  • dehydrogenase/reductase (SDR family) member 10,retinal short-chain dehydrogenase/reductase 3,short chain dehydrogenase/reductase family 47C, member 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook