Product Browser

Last updated: 2017/1/15
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HSD17B14 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00051171-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human HSD17B14 protein.
  • Immunogen:
  • HSD17B14 (NP_057330.2, 1 a.a. ~ 270 a.a) full-length human protein.
  • Sequence:
  • MATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIPS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of HSD17B14 expression in transfected 293T cell line (H00051171-T01) by HSD17B14 MaxPab polyclonal antibody.

    Lane 1: DHRS10 transfected lysate(29.7 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • HSD17B14
  • Gene Alias:
  • DHRS10,SDR47C1,retSDR3
  • Gene Description:
  • hydroxysteroid (17-beta) dehydrogenase 14
  • Gene Summary:
  • 17-beta-hydroxysteroid dehydrogenases, such as HSD17B14, are primarily involved in metabolism of steroids at the C17 position and also of other substrates, such as fatty acids, prostaglandins, and xenobiotics (Lukacik et al., 2007 [PubMed 17067289]).[supplied by OMIM
  • Other Designations:
  • dehydrogenase/reductase (SDR family) member 10,retinal short-chain dehydrogenase/reductase 3,short chain dehydrogenase/reductase family 47C, member 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook