AADAT purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
AADAT MaxPab polyclonal antibody. Western Blot analysis of AADAT expression in human liver.
Western Blot (Transfected lysate)
Western Blot analysis of AADAT expression in transfected 293T cell line (H00051166-T01) by AADAT MaxPab polyclonal antibody.
Lane 1: AADAT transfected lysate(47.19 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human AADAT protein.
Immunogen
AADAT (AAH31068.1, 1 a.a. ~ 429 a.a) full-length human protein.
Sequence
MNYARFITAASAARNPSPIRTMSEKRADILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYQPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQLIKESL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (72); Rat (71)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
AADAT MaxPab polyclonal antibody. Western Blot analysis of AADAT expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of AADAT expression in transfected 293T cell line (H00051166-T01) by AADAT MaxPab polyclonal antibody.
Lane 1: AADAT transfected lysate(47.19 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — AADAT
Entrez GeneID
51166GeneBank Accession#
BC031068.1Protein Accession#
AAH31068.1Gene Name
AADAT
Gene Alias
KAT2, KATII
Gene Description
aminoadipate aminotransferase
Gene Ontology
HyperlinkGene Summary
This gene encodes a protein that is highly similar to mouse and rat kynurenine aminotransferase II. The rat protein is a homodimer with two transaminase activities. One activity is the transamination of alpha-aminoadipic acid, a final step in the saccaropine pathway which is the major pathway for L-lysine catabolism. The other activity involves the transamination of kynurenine to produce kynurenine acid, the precursor of kynurenic acid which has neuroprotective properties. Two alternative transcripts encoding the same isoform have been identified, however, additional alternative transcripts and isoforms may exist. [provided by RefSeq
Other Designations
L kynurenine/alpha aminoadipate aminotransferase|L-kynurenine/alpha-aminoadipate aminotransferase|alpha-aminoadipate aminotransferase|kynurenine aminotransferase II
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com