Product Browser

Last updated: 2017/8/13

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

AADAT purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00051166-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human AADAT protein.
  • Immunogen:
  • AADAT (AAH31068.1, 1 a.a. ~ 429 a.a) full-length human protein.
  • Sequence:
  • MNYARFITAASAARNPSPIRTMSEKRADILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYQPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQLIKESL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • AADAT MaxPab polyclonal antibody. Western Blot analysis of AADAT expression in human liver.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of AADAT expression in transfected 293T cell line (H00051166-T01) by AADAT MaxPab polyclonal antibody.

    Lane 1: AADAT transfected lysate(47.19 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • AADAT
  • Gene Alias:
  • KAT2,KATII
  • Gene Description:
  • aminoadipate aminotransferase
  • Gene Summary:
  • This gene encodes a protein that is highly similar to mouse and rat kynurenine aminotransferase II. The rat protein is a homodimer with two transaminase activities. One activity is the transamination of alpha-aminoadipic acid, a final step in the saccaropine pathway which is the major pathway for L-lysine catabolism. The other activity involves the transamination of kynurenine to produce kynurenine acid, the precursor of kynurenic acid which has neuroprotective properties. Two alternative transcripts encoding the same isoform have been identified, however, additional alternative transcripts and isoforms may exist. [provided by RefSeq
  • Other Designations:
  • L kynurenine/alpha aminoadipate aminotransferase,L-kynurenine/alpha-aminoadipate aminotransferase,alpha-aminoadipate aminotransferase,kynurenine aminotransferase II
  • RSS
  • YouTube
  • Linkedin
  • Facebook