Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

C1orf33 (Human) Recombinant Protein (P01)

  • Catalog # : H00051154-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human C1orf33 full-length ORF ( AAH03013, 1 a.a. - 239 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MPKSKRDKKVSLTKTAKKGLELKQNLIEELRKCVDTYKYLFIFSVANMRNSKLKDIRNAWKHSRMFFGKNKVMMVALGRSPSDEYKDNLHQVSKRLRGEVGLLFTNRTKEEVNEWFTKYTEMDYARAGNKAAFTVSLDPGPLEQFPHSMEPQLRQLGLPTALKRGVVTLLSDYEVCKEGDVLTPEQARVLKLFGYEMAEFKVTIKYMWDSQSGRFQQMGDDLPESASESTEESDSEDDD
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 52.03
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00051154-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • MRTO4
  • Gene Alias:
  • C1orf33,MRT4,dJ657E11.4
  • Gene Description:
  • mRNA turnover 4 homolog (S. cerevisiae)
  • Gene Summary:
  • This gene encodes a protein sharing a low level of sequence similarity with ribosomal protein P0. While the precise function of the encoded protein is currently unknown, it appears to be involved in mRNA turnover and ribosome assembly. [provided by RefSeq
  • Other Designations:
  • 60S acidic ribosomal protein PO,MRT4, mRNA turnover 4, homolog,OTTHUMP00000002580,ribosomal protein P0-like protein,ribosomal protein, large, P0-like
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook