Product Browser

Last updated: 2017/8/20
  • Related Product Showcase
  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

C1orf33 MaxPab mouse polyclonal antibody (B01)MaxPab

  • Catalog # : H00051154-B01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human C1orf33 protein.
  • Immunogen:
  • C1orf33 (NP_057267, 1 a.a. ~ 239 a.a) full-length human protein.
  • Sequence:
  • MPKSKRDKKVSLTKTAKKGLELKQNLIEELRKCVDTYKYLFIFSVANMRNSKLKDIRNAWKHSRMFFGKNKVMMVALGRSPSDEYKDNLHQVSKRLRGEVGLLFTNRTKEEVNEWFTKYTEMDYARAGNKAAFTVSLDPGPLEQFPHSMEPQLRQLGLPTALKRGVVTLLSDYEVCKEGDVLTPEQARVLKLFGYEMAEFKVTIKYMWDSQSGRFQQMGDDLPESASESTEESDSEDDD
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of MRTO4 expression in transfected 293T cell line (H00051154-T01) by MRTO4 MaxPab polyclonal antibody.

    Lane 1: C1orf33 transfected lysate(26.29 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • MRTO4
  • Gene Alias:
  • C1orf33,MRT4,dJ657E11.4
  • Gene Description:
  • mRNA turnover 4 homolog (S. cerevisiae)
  • Gene Summary:
  • This gene encodes a protein sharing a low level of sequence similarity with ribosomal protein P0. While the precise function of the encoded protein is currently unknown, it appears to be involved in mRNA turnover and ribosome assembly. [provided by RefSeq
  • Other Designations:
  • 60S acidic ribosomal protein PO,MRT4, mRNA turnover 4, homolog,OTTHUMP00000002580,ribosomal protein P0-like protein,ribosomal protein, large, P0-like
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook